Catégorie: Les mots des mets

Les mots des mets (la saveur cachée des mots)

Rubis sur l’ongle
C’est une expression vinique !
Le saviez-vous ?

Rubis via gembid.fr

Comme pour beaucoup d’expressions, il y a eu glissement de la signification première à la signification actuelle.

C’est le cas pour « rubis sur l’ongle », idiotisme attesté au XVIIe siècle avec le sens : « boire son verre jusqu’à la dernière goutte » !

On a d’ailleurs d’abord dit « faire rubis sur l’ongle », puis « boire rubis sur l’ongle », et enfin « payer (ou être payé) rubis sur l’ongle »

Mais pourquoi ça, me direz-vous ? Car l’image ne frappe pas l’esprit au premier abord.

Eh bien, c’est parce que, lorsqu’un groupe d’amis se livrait à des libations — pour ne pas dire à des beuveries —, il n’était pas rare qu’il y ait un absent qui n’ait pas pu se joindre à la fête.
On avait alors coutume de verser la dernière goutte de son verre sur son ongle, puis on la léchait pour marquer son attachement à cette personne et le regret qu’elle fut absente. Un peu comme on porte un toast.
Or, cette petite goutte rouge — le vin a d’abord été rouge ! — faisait… comme un rubis sur l’ongle ! D’où l’expression.

Puis la métaphore a évolué : payer jusqu’au dernier centime — en liquide ? — c’est un peu comme boire jusqu’à la dernière goutte, non ? C’est ainsi que la locution adverbale « payer rubis sur l’ongle » a pris l’acception de payer comptant sans rechigner, au détriment de sa première signification.

Moi, ces petites anecdotes me régalent !
Pas vous ?

Si vous voulez savoir comment le vin blanc a gagné ses galons — merci la gibelotte ! — alors qu’avant on ne buvait que du vin rouge, c’est ici :
http://gretagarbure.com/2013/08/06/nos-mille-feuilles-morceaux-choisis-17/

Et pour découvrir d’autres idiotismes culinaires, c’est là : 
http://gretagarbure.com/2014/07/07/les-mots-des-mets-la-saveur-cachee-des-mots-39/

Blandine Vié

Les mots des mets (la saveur cachée des mots)

Boire en Suisse

Gardes suisses 1757 par Marbot

Gardes suisses 1757 par Marbot

Tout d’abord, précisons que cette expression ne signifie pas « boire en Helvétie » mais « boire comme un Suisse », autrement dit… seul !
Mais la langue française a ses subtilités… et ses joies !
Moi-même, j’ai vécu en Suisse dans une vie antérieure — d’accord, c’était à Lugano ! — et j’ai longtemps écrit pour une revue neuchâteloise…

Cela étant dit, les plaisirs solitaires peuvent avoir leur charme. Enfin… jusqu’à un certain point !
Boire en fait partie. Quand c’est pour le plaisir de boire et non pour noyer des chagrins.
Moi par exemple, j’aime bien boire un verre en fin d’après-midi pendant que je suis à mon clavier. Ce n’est pas par misanthropie mais parce que ça rebooste mes neurones mis à rude épreuve depuis 7 h du matin. Allez, avouons, quelquefois depuis 8 h seulement !

Verre de rosé au clavier © Greta Garbure

Bon, ce préambule étant posé,  pourquoi boire seul se dit « boire en Suisse » ?

Eh bien, tout ça, c’est la faute de Stanislas Leszcynski qui, rappelons-le, fut roi de Pologne (Lvov, la ville où il est né, se situe aujourd’hui en Ukraine), Grand-Duc de Lituanie, beau-père de Louis XV, et subséquemment, duc de Lorraine !

Stanislas Leszcynski par Jean Girardin

Stanislas Leszcynski par Jean Girardin

On raconte qu’il recevait souvent du vin de Tokay — le veinard ! — mais qu’il avait la fâcheuse habitude de le couper avec de l’eau ! Franchement ? Une fine à l’eau, d’accord ! Mais un Tokay à l’eau, c’est un crime, non ?

Mais, comme il était quand même amateur de ce vin, il sortait de temps à autre pour aller en boire un verre dans l’antichambre des gardes suisses (les gardes suisses ont constitué la garde royale des rois de France entre 1616 et 1792) ! C’est du moins ce qu’a raconté sa maîtresse en titre, la marquise de Prie : « Il est allé boire en Suisse ! »

Autant que possible, évitons donc d’avoir le verre solitaire !

Blandine Vié

Les mots des mets (la saveur cachée des mots)

Royale, Dauphine, Duchesse,
Princesse, Marquise et autres :
toute l’aristocrassiette !

De nombreux personnages de Cour se sont illustrés par les fastes de leur table, sans forcément laisser de nom à une spécialité particulière. Mais cette cuisine de Cour a néanmoins laissé des traces dans la nomenclature culinaire, même si on ne sait pas toujours pourquoi.

Parmi les plus connues de ces appellations, citons :

— Pommes duchesse : sorte de croquettes à base de purée de pommes de terre très « serrée », liée avec un œuf entier et deux jaunes, puis dressée sur plaque à la poche à douille selon un motif choisi. Les pommes duchesse finissent de cuire au four.

Pommes Duchesse via traditioncuisine.com

— Pommes dauphine : beignets de pommes de terre préparés avec deux tiers d’appareil à pommes duchesse et un tiers de pâte à choux. La pâte est alors façonnée en boules elles-mêmes roulées dans la farine, puis jetées dans la friture.

Pommes dauphine via laurenceel.com

— Sauce princesse : béchamel dans laquelle on incorpore de la gelée de veau, ou, à la rigueur, du jus de volaille.

— Marquise au chocolat : dessert dont la composition s’apparente à celle de la mousse au chocolat, mais en plus ferme, assez ferme en tout cas pour être moulée au froid… et donc démoulée. Autrefois, on servait la marquise sur un socle de biscuits à la cuillère, mais cet usage est tombé en désuétude. Aujourd’hui, on l’accompagne plutôt d’une crème anglaise.

Marquise au chocolat via chocolable

— Royale : préparation à la texture onctueuse comme une crème cuite au bain-marie, à base d’asperge, de céleri, de carotte, de cèpe de foie gras ou de tourteau. La royale est le plus souvent cuite en timbale individuelle. Servie froide et détaillée en cubes ou en dés, elle s’ajoute à un bouillon ou à un consommé qu’on appelle alors « à la royale ».

Lièvre à la royale via foodinantout.fr

Lièvre à la royale via foodinantout.fr

— À la royale (volaille, lièvre ou poisson) : volaille (poularde, chapon) pochée à court mouillement (peu de liquide) et nappée d’un velouté à la crème et à la purée de truffes. Idem pour un poisson. Le lièvre « à la royale » est également apprêté avec une sauce veloutée faite à partir de fond de volaille, de crème et de truffe, mais plus brune.

— Glaçage royal : sucre glace travaillé avec du blanc d’œuf et quelques gouttes de jus de citron jusqu’à l’obtention d’une pâte lisse et coulante qu’on étale sur un gâteau à l’aide d’une lame souple. Il faut le laisser sécher jusqu’à ce qu’il ait durci.

Et le riz à l’impératrice ?

Riz à l'Impératrice via kochbuchfuermaxundmorit.blogspot.fr

Cette impératrice, c’est Eugénie de Montijo, comtesse espagnole qui devint l’épouse de Napoléon III dans la deuxième moitié du XIXe siècle. Ce plat fut-il créé en son honneur ? L’histoire ne le dit pas, seule la recette subsiste. Le riz à l’impératrice est un entremets de riz au lait vanillé additionné d’une macédoine de fruits confits macérés au kirsch et d’une crème anglaise enrichie de crème fouettée. Le tout étant versé dans un moule garni d’une couche épaisse de gelée de groseille et mis à rafraîchir. À la Cour impériale, il était démoulé dans une coupe en cristal.

Cette aristocrassiette invite au partage !

Blandine Vié

Les mots des mets (la saveur cachée des mots)

Tomber dans les pommes !

Pommes via domaine-darmandieu.com

Ah, ces pommes !

Depuis celle qu’Ève a osé croquer — la « pomme de discorde » originelle — que ne leur a-t-on attribué comme vertus, malédictions, métaphores, légendes et anecdotes.
Ce ne sont pas Newton, Guillaume Tell, Blanche-Neige, Adam (la pomme d’Ève lui est restée en travers de la gorge), Beethoven (pom pom pom pom !), New York ni même mon Mac qui vous diront le contraire !

Même d’un point de vue étymologique, elles ont généré une foultitude de mots, ce qui ne se soupçonne pas toujours du premier coup. Nous y reviendrons une prochaine fois.

Par exemple en italien, une tomate se dit « pomodoro » (pomme d’or) — expression flatteuse — alors qu’une aubergine se nomme « melanzana », exactement  « mela insana »… c’est-à-dire « pomme malsaine » ! Pour plus de précisions, c’est ici : http://gretagarbure.com/2013/08/04/reconnaissance-du-ventre-24/

Mais quelquefois, la pomme est invitée dans une expression à son insu !
Inversion cocasse, ce n’est pas le ver dans le fruit… mais le fruit qui joue le rôle du ver !
C’est ce qui se passe dans le cas présent avec notre expression « tomber dans les pommes ». Car autrefois, on disait « tomber dans les pâmes », ce qui deviendra « tomber en pâmoison », autrement dit s’évanouir.
Le sens est toujours le même, mais les pommes n’y ont jamais rien eu à voir, elles ne sont arrivées là que par corruption de langage !

?????

Blandine Vié

Les mots des mets (la saveur cachée des mots)

Quand la cuisine s’habille…
ou se déshabille !

(Les allusions vestimentaires en cuisine 2)

Pour les mots de A à D, c’est là :
http://gretagarbure.com/2014/09/08/les-mots-des-mets-la-saveur-cachee-des-mots-41/

DÉSHABILLER (une cervelle)

Déshabiller une cervelle consiste à la débarrasser de sa membrane et de son réseau de filaments sanguins.

Cervelle de porc via ciprosain.be

EN CHEMISE (Nègre)

C’est le nom d’un dessert tombé en désuétude qui se compose d’un gâteau ou d’un entremets au chocolat (riz au lait) — donc de couleur marron —, ensuite nappé de crème anglaise ou de crème Chantilly, donc de couleur blanche. On comprend bien l’allusion !
Pour en savoir plus, c’est là :

http://gretagarbure.com/2013/08/23/desserts-de-grand-mere-5/

Nègre en chemise via petit-chef-et-ratatouill.skyrock.com

EN CHEMISE (gousses d’ail)

On emploie ce mot pour les gousses d’ail qu’on débarrasse de leurs premières enveloppes tout en laissant les dernières, ce qui fait qu’elles ont l’air d’être « en chemise ». On les fait rôtir ainsi, en cocotte ou au four, généralement pour accompagner un gigot ou une pièce d’agneau.
Il est amusant de noter que les enveloppes ou peaux des gousses d’ail s’appellent elles-mêmes des tuniques (voir ce mot).

Gousses d'ail en chemise via annehelene.fr

FAIRE LE RUBAN

Travailler des jaunes d’œufs et du sucre en poudre en les fouettant jusqu’à ce le mélange blanchisse et devienne souple, fluide et lisse, dessinant des rubans dans la pâte quand on soulève le fouet ou la spatule.

Faire le ruban © Greta Garbure

Faire le ruban © Greta Garbure

FETTUCINE

Pâtes laminées dont le nom italien signifie « petits rubans » !

Fettuccine paille et foin via pastamontegrappa.com

FRAISE (de veau)

Nom de la membrane intestinale du veau qui, après sa préparation par le tripier (lavage, pochage dans l’eau bouillante), il devient blanc et ferme et ressemble aux collerettes que portaient nos aïeux de bonne famille jusqu’au XVIIe siècle. Interdite à la vente depuis l’affaire de la vache folle en 2000, elle était la composante essentielle de l’andouillette de Troyes.

Fraise de veau via ville-retournac.fr

HABILLER (un poisson ou une volaille)

Habiller est un terme désignant l’ensemble des actions nécessaires à la préparation d’un poisson ou d’une volaille avant cuisson. Pour un poisson par exemple : l’écailler, l’ébarber, le vider et lever ses filets.

Habiller un poisson via lappart-des-spasmos.fr

MANCHON

Haut de l’aile du canard sans son aileron, autrement dit la partie la plus charnue. Nom sans doute donné parce qu’il correspond métaphoriquement au bras, donc à la manche, donc au manchon, cet accessoire démodé, ce fourreau cylindrique ouvert aux deux extrémités et fourré pour tenir chaud aux mains l’hiver.

Manchons de canard confits via recettessimples.fr

MOUSSELINE (pommes, sauce)

Les préparations qualifiées de « mousseline » le sont par analogie avec l’étoffe éponyme, toile fine, transparente et vaporeuse qui se caractérise surtout par sa légèreté.
Les pommes mousseline sont une purée de pommes de terre additionnées de jaunes d’œuf et de crème fouettée.
La sauce mousseline est une sauce hollandaise à laquelle on incorpore au dernier moment de la crème fouettée. Pour en savoir plus et avoir le détail de la recette, c’est là :
http://gretagarbure.com/2014/05/30/savoir-faire-26/

Mousseline de pommes de terre au beurre fumé © Blandine Vié

PALETOT (de canard)

Ce qui reste d’un canard gras quand on l’a complètement ouvert et qu’on a prélevé son foie (gras) et toutes ses entrailles.

Paletot de canard via potager76.fr

ROBE (vin)

 La robe d’un vin désigne tout son aspect visuel et plus particulièrement sa couleur.

Robe vin rosé © Greta Garbure

Robe vin rosé © Greta Garbure

ROBE DES CHAMPS

On le dit des pommes de terre cuites dans leur peau à l’eau bouillante ou au four (enveloppées d’aluminium).
Par corruption de langage, l’expression s’est peu à peu confondue avec en « robe de chambre » qui est pourtant totalement fantaisiste.

Pommes de terre en robe des champs via fr.wikipedia.org

SABOT (plat)

Un plat sabot est un plat à four ovale d’une hauteur de 6 cm environ. Généralement, on y prépare les gratins et de nombreux autres plats.
Traditionnellement, le pâté breton est cuit dans un plat sabot et non dans une terrine.
L’allusion au mot sabot vient de sa forme ovale et de sa rusticité, comme les sabots campagnards.

Plat sabot via chomette.com

 

SEMELLE (dur comme de la)

Se dit d’une viande trop cuite, aussi dure… qu’une semelle de chaussure !

Semelles via fages-aiglon.fr

SEMELLES (d’aubergine)

Tranches épaisses (1 cm) d’aubergine coupées dans la longueur et, de par leur forme ovale, faisant penser à des semelles d’espadrilles.

Semelles d'aubergines via a-vos-becs.fr

TROUSSER

Du temps où les femmes portaient des robes longues, ce mot signifiait « relever un vêtement du bas, le retrousser ». Par extension populaire et grivoise, cela voulait donc dire « posséder une femme » (au sens figuré).
Par métaphore, le mot s’emploie aussi en cuisine pour immobiliser les membres et le cou d’une volaille contre son corps (poulet, pintade, etc.) mais sans utiliser ni aiguille ni ficelle.
Donc, à ne pas confondre avec le terme « brider » qui signifie ficeler, étape qui suit le troussage.

Trousser une volaille via lesotlylaisse.over-blog.com

TUNIQUE

Nom donné aux différentes enveloppes ou peaux des plantes condimentaires telles que les oignons, les échalotes et l’ail.

Tuniques d'oignons, échalotes et ail © Greta Garbure

Tuniques d’oignons, échalotes et ail © Greta Garbure

TURBAN (de semoule)

On donne à certaines préparations élaborées dans un moule à savarin (en forme de couronne) le nom de turban, à cause de leur ressemblance avec le couvre-chef éponyme.
Le turban de semoule est un grand classique des desserts de grand-mère.

Turban de semoule via lesfoodies.fr

VOILE

Matière pulvérulente (sucre en poudre, sucre glace, cacao amer en poudre, chapelure, etc.) dont on poudre certains gâteaux ou gratins en très fine épaisseur, à la manière d’un léger voile.

Beignets via campingsitesetpaysagesdefrance.wordpresse.com

Blandine Vié